PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000250031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 394aa    MW: 43967.8 Da    PI: 10.4224
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000250031genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-161764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+ eEd+ll ++v ++G g+W ++ar  g++R++k+c++rw +yl
    MDP0000250031 17 KGSWSREEDKLLSEYVSLHGEGRWGSVARSTGLKRSGKSCRLRWVNYL 64
                     799*******************************************97 PP

2Myb_DNA-binding41.33.5e-1370113146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg  T++E++++v++++++G++ W+tIar+ + gRt++++  + ++
    MDP0000250031  70 RGHITPQEEDIIVELHALWGNK-WSTIARYXP-GRTDNEVGRHANN 113
                      6778******************.*********.*******999988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.0981268IPR017930Myb domain
SuperFamilySSF466891.61E-2614107IPR009057Homeodomain-like
SMARTSM007178.5E-151666IPR001005SANT/Myb domain
PfamPF002491.5E-151764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-211871IPR009057Homeodomain-like
CDDcd001672.69E-111964No hitNo description
SMARTSM007173.4E-1069117IPR001005SANT/Myb domain
PROSITE profilePS5129415.91569119IPR017930Myb domain
PfamPF002496.8E-1170113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-1772110IPR009057Homeodomain-like
CDDcd001671.30E-774115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MVAMMGWGGV AEQGWRKGSW SREEDKLLSE YVSLHGEGRW GSVARSTGLK RSGKSCRLRW  60
VNYLRPGLKR GHITPQEEDI IVELHALWGN KWSTIARYXP GRTDNEVGRH ANNRLIGETK  120
KIKGQISLPI YYYVIAVINQ LIKSLDTCMQ RKAERXRAKQ MDNITASELA GFGVGTLLLC  180
ATIAAPKIDA FISXSQRSSL GMCKRCGNLR LIACSRCKGI GLIKEGEMLG XNLIDDMYES  240
LGGEGSKLRS IXCTKCQARG HLCYLRKINQ CXSFLRPQSP YLFGTSDHNQ TGKRLLSSFQ  300
AFPQHASDKT STAKIKHPVT PVFTPVVSRH VSAQSILLFE GQTPFESVRR FRHQSCPSPG  360
TVLTPNXRST XSRWMAALTL LLGLGNWRFS EVGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-20711517124MYB TRANSFORMING PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1184223
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.13e-49myb domain protein 305